Everything below concerns lyophilisation. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Receptor binding at MC1R on melanocytes raises intracellular cyclic AMP and increases expression of tyrosinase and related enzymes. The downstream result is greater synthesis of eumelanin, the dark pigment, without ultraviolet exposure acting as the trigger. The compound is not selective, however, and also engages MC3R, MC4R and MC5R, which are expressed in the central nervous system and elsewhere. That lack of selectivity is the explanation usually offered for effects reported outside pigmentation, including appetite suppression and nausea. Selectivity remains a central theme in comparative studies of related peptides.
Human data remain limited and mostly short-term. Reports describe small trials and observational accounts rather than large controlled studies, so questions about dose-response relationships and long-term effects on melanocytes stay open. Whether repeated exposure alters naevus behaviour is not settled in the published record. Researchers also note that self-administered use outside clinical settings makes actual exposure difficult to quantify. Statements about efficacy and safety should therefore be read as preliminary rather than established.
Lyophilised melanotan-2 is supplied as a solid, which is more stable than a solution. The material is hygroscopic, so weighing is done quickly, in low humidity, with the container kept sealed. Reconstitution usually uses water for injection or bacteriostatic water, added down the wall of the vial to limit foaming. A reconstituted solution is held at 2 to 8 °C and kept away from light. Repeated freezing and thawing of the same vial is avoided because ice crystal formation and concentration effects degrade the peptide.
Reversed-phase high-performance liquid chromatography is the routine method for purity assessment. Peptides absorb near 214 nm because of the peptide bond, and a gradient of acetonitrile in water separates the intact peptide from deletion sequences, oxidised products, and earlier-eluting fragments at neutral pH. Electrospray ionisation mass spectrometry provides an orthogonal check: the measured mass must agree with the theoretical value. Amino acid analysis and peptide mapping confirm structure but are used less often. Reference standards remain scarce because the peptide is not described in any pharmacopoeia.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic cyclic heptapeptide | Melanocortin receptor agonist |
| Molecular formula | C50H69N15O9 | Neutral form, mass near 1024.2 g/mol |
| Primary targets | MC1R, MC3R, MC4R, MC5R | Binding is non-selective across subtypes |
| Related compounds | Alpha-MSH, melanotan I, afamelanotide | Structurally or functionally related peptides |
| Common abbreviations | MT-II, MT-2 | Naming in the literature is not uniform |
Melanotan-2, also written Melanotan II, is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone. Its sequence is Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, and the lactam bridge between the aspartate and lysine side chains constrains the peptide into a ring. This structural change increases receptor affinity and metabolic stability relative to the native hormone. The compound was created in the 1980s as a research tool for studying pigmentation biology.
Melanocytes are the pigment-producing cells of the skin, and they carry melanocortin-1 receptors on their surface. When the receptor is activated, cyclic adenosine monophosphate rises inside the cell and raises the activity of enzymes such as tyrosinase, which increases melanin output. Melanotan-2 binds melanocortin-1 receptors in vitro and in animal models, and this binding is generally described as the basis for the tanning effect. Other receptors account for different effects: melanocortin-4 receptors contribute to appetite and erectile signalling, while melanocortin-3 and melanocortin-5 receptors contribute to energy balance and exocrine function.
Early published reports described melanotan-2 as a tanning agent without sun protection, which means darkening is not the same as protection against ultraviolet radiation. Later studies explored the peptide in erectile dysfunction, hemorrhagic shock, and some skin conditions. No regulator in the United States or Europe has approved it for clinical use. Many products labelled melanotan-2 are sold without approval and their identity and purity are unverified. Its long-term safety in humans remains an open question.
Lyophilized peptide powder is generally stored frozen, protected from light and moisture. Tryptophan residues are susceptible to oxidation, and the lactam bridge can hydrolyze under strongly acidic or basic conditions. Solutions prepared for laboratory work degrade faster than dry powder, and repeated freeze-thaw cycles accelerate loss. Common practice is to aliquot solutions before freezing and to avoid alkaline buffers. Reported stability windows vary with concentration, buffer, and temperature, so exact shelf lives are method-specific rather than universal.
Regulatory status differs by country, and in many places supplying the compound for human consumption is unlawful. Vendors frequently label material as intended for research use only, a designation that shifts stated purpose but does not create a legal pathway for personal use. Certificates of analysis accompanying such products vary widely in detail and provenance. Third-party testing exists but is voluntary, and results are rarely linked to a specific lot in a publicly verifiable way.
Melanotan II is a synthetic cyclic heptapeptide analog derived from the core sequence of alpha-melanocyte-stimulating hormone. Researchers at the University of Arizona synthesized it during the 1980s while studying pigmentation and appetite signaling. The compound is not an approved medicine in any major jurisdiction and appears mainly in laboratory and research-chemical settings. Its structure incorporates a lactam bridge between side chains, which constrains the ring and slows enzymatic breakdown relative to the natural hormone.
Melanotan II binds several melanocortin receptor subtypes rather than a single target. MC1R on melanocytes drives melanin synthesis, while MC3R and MC4R participate in energy balance, appetite, and sexual response pathways. This lack of selectivity explains why reported effects extend beyond skin darkening. Substitutions at positions four and seven, including norleucine and D-phenylalanine, increase potency and resistance to peptidases. Understanding which receptor mediates which effect remains an active area of investigation.
Published human data come mostly from small, short studies rather than large controlled trials. Reported outcomes include increased skin pigmentation and, in some reports, effects on appetite and libido, but sample sizes are small and follow-up is limited. Whether long-term use produces durable pigment changes or adverse effects is not established. Because products sold outside pharmacies are not standardized, the actual content of any given vial is often unknown. Independent testing of such material is uncommon.
Bank served with various Office of Strategic Services (OSS) units, including Jedburgh teams advising and leading French Resistance units before the Battle of Normandy ("D-Day" invasion) of 6 June 1944. LTC Martin was a mustang, having enlisted at age 17; he was promoted to second lieutenant during WWII. Before being commissioned he was the US VIIth Army's Boxing Champion for his weight class. He served as a company commander with the 82 Airborne and saw action in North Africa, Sicily, Market Garden, and the Battle of the Bulge. He received his third combat jump star in Korea while serving with the 187th Regimental Combat Team. He retired as an LTC at age 37 while serving in Bad Tölz with the 10th Special Forces Group. The 10th SFG deployed to Bad Tölz, Germany the following September. The remaining cadre at Fort Bragg, North Carolina formed the 77th Special Forces Group, which in May 1960 became 7th Special Forces Group. The Special Forces branch was established as a basic branch of the United States Army on 9 April 1987, by Army General Order No. 35.
The white shark is difficult to keep in captivity due to its large size and migratory nature. Attempts have been made since 1955 in facilities in North America, Hawaii, Australia, and South Africa. The sharks survived only for days during the earliest attempts, while in the early 1980s, aquariums like Steinhart Aquarium, Sea World San Diego, and Marineland of the Pacific were able to keep juvenile white sharks for weeks before releasing them. A major contributor to the mortality of captive white sharks was the stress of poor transport; many were accidentally captured by commercial nets and kept on fishing lines or in a tank before being handed over to aquarium staff. One famous shark named Sandy, who measured 2.3 m (7.5 ft), was kept at Steinhart for five days in August 1980 and was released after bumping into the walls. The most successful exhibitions occurred at Monterey Bay Aquarium (MBA), which displayed six white sharks between 2004 and 2011. Researchers at universities in California attributed this success to a 4-million-US-gallon (15,000,000 L) net pen, which gave the sharks time to recover from capture before being moved. Additionally, a 3,200-US-gallon (12,000 L) portable tank allowed the sharks to swim continuously during transit. Although the sharks were 1.4–1.6 m (4.6–5.2 ft) at the start of their stay, they eventually outgrew the exhibit and required release. One shark was kept for 198 days and attracted one million visitors. Having gathered sufficient data on the species, MBA discontinued the program in 2011.
Special chainsaws can cut concrete, brick, and natural stone. These use similar chains to ordinary chainsaws, but with cutting edges embedded with diamond grit. They may use gasoline or hydraulic power, and the chain is lubricated with water, because of high friction and to remove stone dust. The machine is used in construction, for example, in cutting deep, square holes in walls or floors, in stone sculpture for removing large chunks of stone during pre-carving, by fire departments for gaining access to buildings, and in restoration of buildings and monuments for removing parts with minimal damage to the surrounding structure. More recently, concrete chainsaws with electric motors of 230 volts have also been developed. Because the material to be cut is not fibrous, much less kickback occurs. So, the most-used method of cutting is plunge-cutting, by pushing the tip of the blade into the material. With this method, square cuts as small as the blade width can be achieved. Pushback can occur if a block shifts when nearly cut through and pinches the blade, but overall, the machine is less dangerous than a wood-cutting chainsaw.
Sources: en.wikipedia.org
== Types == In mammals, NADPH oxidase is found in two types: one in white blood cells (neutrophilic) and the other in vascular cells, differing in biochemical structure and functions. Neutrophilic NADPH oxidase produces superoxide almost instantaneously, whereas the vascular enzyme produces superoxide in minutes to hours. Moreover, in white blood cells, superoxide has been found to transfer electrons across the membrane to extracellular oxygen, while in vascular cells, the radical anion appears to be released mainly intracellularly.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
History of sonochemistry – history of the study of the effect of sonic waves and wave properties on chemical systems. History of stereochemistry – history of the study of the relative spatial arrangement of atoms within molecules. History of supramolecular chemistry – history of the area of chemistry beyond the molecules and focuses on the chemical systems made up of a discrete number of assembled molecular subunits or components. History of thermochemistry – history of the study of energy and heat associated with chemical reactions and/or physical transformations. History of phytochemistry – history of the study of phytochemicals. History of polymer chemistry – history of the multidisciplinary science that deals with the chemical synthesis and chemical properties of polymers or macromolecules. History of solid-state chemistry – history of the study of the synthesis, structure, and properties of solid phase materials, particularly, but not necessarily exclusively of, non-molecular solids History of multidisciplinary fields involving chemistry: History of chemical biology – history of the scientific discipline spanning the fields of chemistry and biology that involves the application of chemical techniques and tools, often compounds produced through synthetic chemistry, to the study and manipulation of biological systems. History of chemical oceanography – history of the study of the behavior of chemical elements within the Earth's oceans.
Sources: en.wikipedia.org
It is a synthetic cyclic heptapeptide and a non-selective melanocortin receptor agonist. Structurally it is modelled on alpha-melanocyte-stimulating hormone, a peptide that occurs naturally in the body.
Activation of MC1R increases pigment synthesis independently of ultraviolet exposure, which is the mechanism usually cited for darkening without sun exposure. Ultraviolet light still influences skin response through separate biological pathways.
Because the peptide binds several melanocortin receptor subtypes, its effects are not confined to pigmentation. This complicates interpretation of both intended and unintended outcomes reported in studies.
Low temperature slows hydrolysis and oxidation, the two main routes by which the peptide backbone and side chains are modified. A lyophilised powder stored at −20 °C is more stable than one kept at room temperature, and once the material is dissolved the degradation rate rises, making refrigeration more important.