A practical reference on melanocortin receptor: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-08-28. Anything still debated is marked as such rather than presented as settled.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, which separates the target peptide from truncated or oxidised impurities. Mass spectrometry, most often coupled to liquid chromatography, confirms molecular mass and detects substitutions that chromatography alone may miss. Amino acid analysis and peptide mapping supply additional structural evidence, while nuclear magnetic resonance is reserved for full structural confirmation. Laboratories that examine samples sold online report wide variation in actual content, with some vials containing little or none of the labelled material.
Melanotan-2 appears on the World Anti-Doping Agency prohibited list within the peptide hormone class, and several national regulators treat it as an unapproved prescription substance. Some countries restrict importation or sale for personal use. Because the compound is widely traded as a research chemical, the practical legal picture differs between jurisdictions and shifts over time. Human safety data covering long periods are limited, and whether repeated pigmentation changes carry any lasting risk to melanocytes remains an open question.
Human data remain limited and mostly short-term. Reports describe small trials and observational accounts rather than large controlled studies, so questions about dose-response relationships and long-term effects on melanocytes stay open. Whether repeated exposure alters naevus behaviour is not settled in the published record. Researchers also note that self-administered use outside clinical settings makes actual exposure difficult to quantify. Statements about efficacy and safety should therefore be read as preliminary rather than established.
Melanotan II is a synthetic cyclic heptapeptide that acts as an agonist at melanocortin receptors. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous peptide involved in pigment production. The analogue carries a lactam bridge that constrains the ring and slows enzymatic breakdown relative to the native hormone. In research literature it appears under several abbreviations, and naming conventions are not fully standardized. Published descriptions usually place it within the broader melanocortin agonist family.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | -20 °C or below | For the lyophilised powder, desiccated |
| Storage form | Sealed vial, protected from light | Amber glass or foil-wrapped containers |
| Reconstituted stability | Short, refrigerate | Degradation accelerates in solution |
| Typical analytical method | Reversed-phase HPLC with mass spectrometry | Purity assessment plus identity confirmation |
| Common synonyms | Melanotan II, MT-II | Also written melanotan-2 |
Routine characterisation relies on reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres, using a C18 column and a water-acetonitrile gradient containing trifluoroacetic acid. Electrospray ionisation mass spectrometry confirms the expected molecular mass and can reveal truncated or oxidised by-products that co-elute poorly. Sequence and stereochemistry require additional work, such as peptide mapping or amino acid analysis, because a chromatographic purity figure alone does not distinguish a diastereomer from the target peptide. Independent testing of research-grade material frequently shows measured content below the stated label, so a certificate of analysis is best read together with the method that produced it.
Melanotan-2 is handled in the laboratory as a lyophilised powder that dissolves readily in water, dimethyl sulfoxide and dimethylformamide, with limited solubility in ethanol. Stock solutions prepared in an organic solvent often precipitate when diluted into aqueous buffer, so gradual dilution with mixing is standard practice. The peptide carries a tryptophan residue and a histidine residue, both sensitive to oxidation and to alkaline conditions. Working solutions are therefore kept near neutral to slightly acidic pH, protected from light, and consumed within the same working session whenever that is practical.
Published pharmacokinetic information is limited and comes mainly from small studies rather than registrational trials. Plasma half-life is usually described as short, on the order of tens of minutes, followed by rapid tissue distribution and clearance of the intact peptide. Metabolites and low concentrations of parent compound have been reported in urine, a detail relevant to anti-doping and forensic testing. Whether repeated exposure changes receptor sensitivity or clearance over time remains an open question. Values differ noticeably between analytical assays, so published numbers should be read as approximate rather than definitive.
Melanotan II is a synthetic cyclic heptapeptide with the sequence Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, corresponding to a molecular formula of C50H69N15O9 and a monoisotopic mass near 1024 daltons. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, a peptide hormone produced by cleavage of proopiomelanocortin. A lactam bridge between the aspartate and lysine side chains closes the ring, and the C-terminal amide removes a free carboxyl group. Both modifications increase resistance to enzymatic degradation compared with the linear parent hormone. Four substitutions distinguish it from afamelanotide, the linear analogue studied under the name melanotan I.
Receptor-binding studies classify melanotan II as a non-selective melanocortin agonist. It interacts with MC1R, MC3R, MC4R and MC5R, with reported affinities in the low nanomolar range and no strong subtype preference. Activation of MC1R on dermal melanocytes shifts pigment synthesis toward eumelanin, the dark polymer deposited in melanosomes and transferred to keratinocytes. Because the same peptide engages MC4R in the hypothalamus, it also appears in animal work on food intake and erectile response, which is why it is discussed in both pigment and metabolic research. Which receptor populations dominate after systemic exposure in humans is not fully established.
Scientific discussion of Melanotan-2 spans pharmacology, dermatology, and public-health literature. Laboratory studies examine its receptor binding and cellular effects, while clinical reports describe outcomes observed after unregulated use. These two bodies of work differ in rigour and intent. Peer-reviewed trials of the compound as a medicine are limited, so much of the available information comes from case reports and surveillance data. Authors frequently note the gap between experimental findings and real-world use.
Reported observations after unregulated use include shifts in skin pigmentation and, in some accounts, unintended changes to moles and other lesions. Whether these outcomes are causally linked to the compound, and how often they occur, remain open questions because controlled data are scarce. The absence of standardised dosing and verified product purity complicates interpretation. Researchers have called for better surveillance and analytical characterisation of samples obtained outside regulated channels. Conclusions drawn from anecdotal evidence should be treated as provisional.
Melanotan-2 has not received marketing authorisation from major regulatory agencies for any therapeutic indication. Several jurisdictions classify it as a prescription-only medicine or a controlled substance when supplied for human use. Because approved products do not exist, material sold online usually sits outside pharmaceutical supply chains and formal quality oversight. Regulators have issued public notices describing the compound as unapproved. Enforcement varies, and the legal position differs between countries, which complicates any single general statement about its status.
A clinical trial produces data that could reveal quantitative differences between two or more interventions; statistical analyses are used to determine whether such differences are true, result from chance, or are the same as no treatment (placebo). Data from a clinical trial accumulate gradually over the trial duration, extending from months to years. Accordingly, results for participants recruited early in the study become available for analysis while subjects are still being assigned to treatment groups in the trial. Early analysis may allow the emerging evidence to assist decisions about whether to stop the study, or to reassign participants to the more successful segment of the trial. Investigators may also want to stop a trial when data analysis shows no treatment effect.
Prazepam is a benzodiazepine derivative drug developed by Warner-Lambert in the 1960s. It possesses anxiolytic, anticonvulsant, sedative and skeletal muscle relaxant properties. Prazepam, (Elimination half-life 29-224h), is a prodrug for desmethyldiazepam, (Elimination half-life 36-200h), which is responsible for the therapeutic effects of prazepam.
=== Carrier Cold Chain === Carrier Cold Chain specializes in temperature-controlled transport and storage for perishable goods across food, healthcare, and pharmaceutical industries. Its products include refrigerated transport equipment, commercial refrigeration systems, and digital monitoring platforms that ensure product quality and safety. This unit supports global supply chains by reducing waste and maintaining precise temperature control from production to delivery.
=== Rings === Ringworld-like megastructures exist in the Culture universe; the texts refer to them simply as "Rings" (with a capital R). As opposed to the smaller orbitals which revolve around a star, these structures are massive and completely encircle a star. Banks does not describe these habitats in detail, but records one as having been destroyed (along with three Spheres) in the Idiran-Culture war. In Matter, the Morthanveld people possesses ringworld-like structures made of innumerable various-sized tubes. Those structures, like Niven's Ringworld, encircle a star and are about the same size.
== Career == As noted in his obituary in Clinical Chemistry, Masahide "graduated from Yamaguchi Medical School in 1961. During 1965, he served as an internist for the Hiroshima Atomic Bomb Casualty Committee. Several years later, in 1967, he was appointed the Chief of the Clinical Chemistry Department at Kawasaki Hospital. In 1970, he did a fellowship in the United States at the Michael Reese Hospital in Chicago, IL, which gave him exposure to the US medical system. Two years later he became an Assistant Professor of Internal Medicine at Kawasaki Medical School and rose quickly in the academic ranks to become a Full Professor of Laboratory Diagnosis in 1976 and, ultimately, Vice President of Kawasaki Paramedical College." He was appointed Professor and Director of the Department of the Clinical Laboratory at Kochi Medical School, Kochi, Japan in 1981. There, he developed his automation system. Masahide published many papers between 1981 and 1999, the most notable of which was a monograph on laboratory automation sponsored by the A&T Corporation.
Sources: en.wikipedia.org
== Further reading == Habibi, N; Kamaly, N; Memic, A; Shafiee, H (2016). "Self-assembled peptide-based nanostructures: Smart nanomaterials toward targeted drug delivery". Nano Today. 11 (1): 41–60. doi:10.1016/j.nantod.2016.02.004. PMC 4834907. PMID 27103939.
=== Antidepressants === Medications that are indicated for both anxiety disorders and depression. Selective serotonin reuptake inhibitors (SSRIs) and serotonin–norepinephrine reuptake inhibitors (SNRIs) are new generations of antidepressants. They have a much lower adverse effect profile than older antidepressants like monoamine oxidase inhibitors (MAOIs) and tricyclic antidepressants (TCAs). Therefore, SSRIs and SNRIs are now the first-line agent in treating long term anxiety disorders, given their applications and significance in all six types of disorders.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
Net protein Utilization (NPU) Protein Efficiency Ratio (PER) Nitrogen Balance (NB) Protein digestibility (PD) Protein Digestibility Corrected Amino Acid Score (PDCAAS) Digestible Indispensable Amino Acid Score (DIAAS) These all hold specific advantages and disadvantages over BV, although in the past BV has been held in high regard.
== Ministries held == After the elections to the Grand National Assembly and the declaration of Bulgaria as a republic, Georgiev stepped down from the premiership at the request of Communist Party leader Georgi Dimitrov. Dimitrov had effectively been leading the country since the monarchy was abolished in September. In the second government of Georgi Dimitrov of 12 December 1947 he was removed from the Foreign Ministry and became Minister of Electrification and Land Reclamation, remaining in this post until 1959, after which he briefly served as Chairman of the Committee on Construction and Architecture. He was Deputy Prime Minister until 1950 and again in 1959–1962. Kimon Georgiev was expelled from the country's political leadership, which was placed under the full control of the Bulgarian Communist Party. At the same time, as Minister of Electrification, he played an important role, as the construction of the power industry was key to the Communists' policy of massive industrialization. Between 1947 and 1959, electricity production increased more than sixfold, and numerous power plants, dams and transmission facilities were built. In 1948, after the revocation of Damyan Velchev's Bulgarian citizenship, the State Security started a secret investigation against Georgiev. This took place in the context of growing tensions between Yugoslavia and the Soviet bloc, and Georgiev was known for his long-standing position in favour of friendly relations between Yugoslavia and Bulgaria.
Sources: en.wikipedia.org
The lyophilised solid is best kept cold, dry and dark, typically at minus twenty degrees Celsius. Moisture and repeated warming cycles are the main causes of degradation. Solutions prepared from the powder are less stable and are normally used quickly.
Reversed-phase liquid chromatography assesses purity, while mass spectrometry confirms molecular mass and detects sequence errors. Amino acid analysis and peptide mapping add structural detail. These techniques are complementary rather than interchangeable.
It is listed as a prohibited peptide hormone by the World Anti-Doping Agency. No medicines regulator has approved it for human use. Import and sale rules vary by country.
It is a synthetic cyclic heptapeptide and a non-selective melanocortin receptor agonist. Structurally it is modelled on alpha-melanocyte-stimulating hormone, a peptide that occurs naturally in the body.